Structure of PDB 7dnf Chain D Binding Site BS01

Receptor Information
>7dnf Chain D (length=153) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLGKKLLEAARAGQDDEVRILMANGADVNANDVYGITPLHLAAYMGHLEI
VEVLLKYGVDVNASDQFGNTPLHLAADDGHLEIVEVLLKHGTDVNATDTW
GSTPLHLAAHRGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLA
EIL
Ligand information
>7dnf Chain E (length=16) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KRIHIGPGRAFYTTPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dnf Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		R23 Y46 I48 H52 Y56 M57 D77 F79 N81 L86 D89 D90 W112 R123
Binding residue
(residue number reindexed from 1)		R11 Y34 I36 H40 Y44 M45 D65 F67 N69 L74 D77 D78 W100 R111
External links