Structure of PDB 7d6r Chain D Binding Site BS01

Receptor Information

>7d6r Chain D (length=70) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVT
IKSSTCESGSGFAEVQFNND

Ligand information

>7d6r Chain G (length=5) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RRRRA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7d6r Identification of a peptide motif that potently inhibits two functionally distinct subunits of Shiga toxin.
Resolution	1.6 Å
Binding residue (original residue number in PDB)	K5 T48 D70
Binding residue (residue number reindexed from 1)	K5 T48 D70

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0019836	hemolysis by symbiont of host erythrocytes

	Cellular Component
GO:0005576	extracellular region

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7d6r, PDBe:7d6r, PDBj:7d6r
PDBsum	7d6r
PubMed	33972673
UniProt	Q7DJJ2

[Back to BioLiP]