Structure of PDB 7csy Chain D Binding Site BS01

Receptor Information
>7csy Chain D (length=95) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NGMRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISA
DMAIRLGRYFDTSAQFWMNLQSEYSLATAYAANGKQIEHEIEPLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7csy Pseudomonas aeruginosa antitoxin HigA functions as a diverse regulatory factor by recognizing specific pseudopalindromic DNA motifs.
Resolution2.29 Å
Binding residue
(original residue number in PDB)
S26 P27 A28 R32 N42
Binding residue
(residue number reindexed from 1)
S23 P24 A25 R29 N39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7csy, PDBe:7csy, PDBj:7csy
PDBsum7csy
PubMed33346387
UniProtQ9HVC1

[Back to BioLiP]