Structure of PDB 7co7 Chain D Binding Site BS01

Receptor Information

>7co7 Chain D (length=329) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VSYANAVSRAAPAVANLYTTKMVSKPSHPLFDDPMFRRFFGDNLPQQKRM
ESSLGSAVIMSAEGYLLTNNHVTAGADQIIVALRDGRETIAQLVGSDPET
DLAVLKIDLKNLPAMTLGRSDGIRTGDVCLAIGNPFGVGQTVTMGIISAT
GRNQLGLNTYEDFIQTDAAINPGNAGGALVDAAGNLIGINTAIFSKSGGS
QGIGFAIPTKLALEVMQSIIEHGQVIRGWLGVEVKALTPELAESLGLGET
AGIVVAGVYRDGPAARGGLLPGDVILTIDKQEASDGRRSMNQVARTRPGQ
KISIVVLRNGQKVNLTAEVGLRPPPAPAP

Ligand information

>7co7 Chain C (length=7) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DELRWVF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7co7 Molecular Basis of the Versatile Regulatory Mechanism of HtrA-Type Protease AlgW from Pseudomonas aeruginosa.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	W281 L282 G283 V284 E285 V286 A308 G338 R339 M342
Binding residue (residue number reindexed from 1)	W229 L230 G231 V232 E233 V234 A256 G286 R287 M290

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7co7, PDBe:7co7, PDBj:7co7
PDBsum	7co7
PubMed	33622718
UniProt	Q9HVX1

[Back to BioLiP]