Structure of PDB 7cjq Chain D Binding Site BS01

Receptor Information
>7cjq Chain D (length=275) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSLRYFYTSVSRPGRGDPRFIAVGYVDDTQFVRFDSDAATGRMEPRAP
WMEQEGPEYWDRETRTVKETAQRYRVDLDTLRGYYNQSEAGSHTRQTMYG
CDLGPGGRLLRGYSQDAYDGADYIALNEDLRSWTAADTAAQITRRKWEAA
GTAEHDRNYLETTCVEWLRRYLEMGKETLLRAEPPSTRVTRHPISDHEVT
LRCWALGFYPAEITLTWQRDGEDQTQDTEVVDTRPAGDGTFQKWAAVVVP
SGQEQRYTCHVQHEGLAEPVTRRWE
Ligand information
>7cjq Chain F (length=9) Species: 11233 (Canine distemper virus strain Onderstepoort) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RTISYTYPF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cjq Structure of canine MHC class I at 2.7 Angstroms resolution
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y8 E64 R74 D78 T81 Y85 R96 Y100 D117 Y124 T144 K147 W148 T153 H156 Y160 W168 Y172
Binding residue
(residue number reindexed from 1)		Y7 E63 R73 D77 T80 Y84 R95 Y99 D116 Y123 T143 K146 W147 T152 H155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links