Structure of PDB 7cfd Chain D Binding Site BS01

Receptor Information
>7cfd Chain D (length=178) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IGSIVGILITFINGPTEVYGQFLDGSPPLVWDKKDVPENKRTFKSKPRLL
DIVLALYSDGCFYRAQIIDEFPSEYMIFYVDYGNTEFVPLSCLAPCENVD
SFKPHRVFSFHIEGIVRSKNLTHQKTIECIEYLKSKLLNTEMNVHLVQRL
PDGFLIRFLDDWKYIPEQLLQRNYAQVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cfd Binding of guide piRNA triggers methylation of the unstructured N-terminal region of Aub leading to assembly of the piRNA amplification complex.
Resolution2.704 Å
Binding residue
(original residue number in PDB)		Y624 Y630 Y646 Y649 N651
Binding residue
(residue number reindexed from 1)		Y57 Y63 Y79 Y82 N84
Enzymatic activity
Enzyme Commision number ?
External links