Structure of PDB 7cfc Chain D Binding Site BS01

Receptor Information
>7cfc Chain D (length=179) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RFLLPPKGGTETTRRDIYNQILKDMAAFPENTIVTAVLASVDVTDNCAYV
AKWDESSDRIKKVLQRQLPLQELDQLPDYGDIFAVLDSINNIITRITINS
SSAGGGYDAYLIDFGEHIHFDGNETIFKLPDDIKRLPAQAIRCDLINCDI
ANMHCFVNTYIKIRVHENNNSTLVAEPVI
Ligand information
>7cfc Chain I (length=10) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GRARLIDTLK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cfc Binding of guide piRNA triggers methylation of the unstructured N-terminal region of Aub leading to assembly of the piRNA amplification complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		W339 K348 L350 Q351 N376 F400 E402 N444 Y446
Binding residue
(residue number reindexed from 1)		W53 K62 L64 Q65 N90 F114 E116 N158 Y160
Enzymatic activity
Enzyme Commision number ?
External links