Structure of PDB 7bre Chain D Binding Site BS01

Receptor Information
>7bre Chain D (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDE
MPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSG
YGQGDVLGFYINLPEDTGRGSSEIIFYKNGVNQGVAYKDIFEGVYFPAIS
LYKSCTVSINFPCFKYPPKDLTYRPMSDM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bre Crystal Structure of MLL2 Complex Guides the Identification of a Methylation Site on P53 Catalyzed by KMT2 Family Methyltransferases.
Resolution2.803 Å
Binding residue
(original residue number in PDB)		Y313 R343 P356 Y359 R367 F374 S377 Y475
Binding residue
(residue number reindexed from 1)		Y28 R58 P71 Y74 R82 F89 S92 Y152
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0048188 Set1C/COMPASS complex

View graph for
Cellular Component
External links
PDB RCSB:7bre, PDBe:7bre, PDBj:7bre
PDBsum7bre
PubMed32697937
UniProtQ9UBL3|ASH2L_HUMAN Set1/Ash2 histone methyltransferase complex subunit ASH2 (Gene Name=ASH2L)

[Back to BioLiP]