Structure of PDB 7bp6 Chain D Binding Site BS01

Receptor Information
>7bp6 Chain D (length=90) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYN
KKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bp6 NAP1-Related Protein 1 (NRP1) has multiple interaction modes for chaperoning histones H2A-H2B.
Resolution1.58 Å
Binding residue
(original residue number in PDB)		I78 S79 S80 K81 M83
Binding residue
(residue number reindexed from 1)		I20 S21 S22 K23 M25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7bp6, PDBe:7bp6, PDBj:7bp6
PDBsum7bp6
PubMed33199628
UniProtQ9LQQ4|H2B1_ARATH Histone H2B.1 (Gene Name=At1g07790)

[Back to BioLiP]