Structure of PDB 7bo9 Chain D Binding Site BS01

Receptor Information
>7bo9 Chain D (length=30) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEFAQAVKEYAKAVKEYAFAVKEYAQAVKG
Ligand information
>7bo9 Chain E (length=29) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GEFAQAVKEYAKAVKEYAFAVKEYAQAVK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bo9 How Coiled-Coil Assemblies Accommodate Multiple Aromatic Residues.
Resolution1.56 Å
Binding residue
(original residue number in PDB)		A6 E9 Y10 A13 V14 Y17 A20 E23 Y24
Binding residue
(residue number reindexed from 1)		A6 E9 Y10 A13 V14 Y17 A20 E23 Y24
External links