Structure of PDB 7b24 Chain D Binding Site BS01

Receptor Information
>7b24 Chain D (length=142) Species: 405948 (Saccharopolyspora erythraea NRRL 2338) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NDLIDTTEMYLRTIYDLEEEGVVPLRARIAERLEQSGGTVSQTVARMERD
GLLTVAEDRHLELTKAGRARAISVMRKHRLAERLLVDVIGLEWEQVHLEA
CRWEHVMSEAVERKLVKLLGNPTTSPYGNPIPGLDELGVGDS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b24 The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		T7 Q36 S37 T40 Q43 R47 R50
Binding residue
(residue number reindexed from 1)		T6 Q35 S36 T39 Q42 R46 R49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 15:23:03 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7b24', asym_id = 'D', bs = 'BS01', title = 'The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7b24', asym_id='D', bs='BS01', title='The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003677,0003700,0006355,0046914,0046983', uniprot = '', pdbid = '7b24', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003700,0006355,0046914,0046983', uniprot='', pdbid='7b24', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>