Structure of PDB 7aw7 Chain D Binding Site BS01

Receptor Information
>7aw7 Chain D (length=93) Species: 227321 (Aspergillus nidulans FGSC A4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTSKEWIIPPRPKPGRKPATDTPPTKRKAQNRAAQRAFRERRAARVSELE
DQIKKIEDDHEIHVATFKEQIANLSREVEQCRTEMGWWRDRSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7aw7 Structural insights into cooperative DNA recognition by the CCAAT-binding complex and its bZIP transcription factor HapX.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R48 P49 G52 R53 K54 Q67 F75 R78 R79
Binding residue
(residue number reindexed from 1)		R11 P12 G15 R16 K17 Q30 F38 R41 R42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aw7, PDBe:7aw7, PDBj:7aw7
PDBsum7aw7
PubMed35472306
UniProtG5EAX9

[Back to BioLiP]