Structure of PDB 6z7z Chain D Binding Site BS01

Receptor Information
>6z7z Chain D (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVKPGGSLKLSCTASGFAFSDYDMSWVRQTPEKRLEWVAF
ISNGGYSTYYPDTVKGRFTISRDNAENTLYLQMSSLKSEDTAIYYCARQG
LRYFDYWGLGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYF
PEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCN
VAHPASSTKVDKKIVPRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6z7z Insulin binding to the analytical antibody sandwich pair OXI-005 and HUI-018: Epitope mapping and binding properties.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		D33 S52 N53 G54 Y56 R102
Binding residue
(residue number reindexed from 1)		D33 S52 N53 G54 Y56 R102
External links