Structure of PDB 6ygi Chain D Binding Site BS01

Receptor Information
>6ygi Chain D (length=152) Species: 489543 (Hepatitis B virus duck/DHBV-16) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDINASRALANVYDLPDDFFPKIDDLVRDAKDALEPYWKSDSIKKHVLIA
THFVDLIEDFWQTTQGMHEIAESLRAVGGSGGAEIHAHLKAYAKINEESL
DRARRLLWWHYNCLLWGEAQVTNYISRLRTWLSTPEKYRGRDAPTIEAIT
RP
Ligand information
>6ygi Chain H (length=13) Species: 489543 (Hepatitis B virus duck/DHBV-16) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSSSHHRSPSPRK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ygi Slowly folding surface extension in the prototypic avian hepatitis B virus capsid governs stability.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y13 D14 K45
Binding residue
(residue number reindexed from 1)		Y13 D14 K45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity

View graph for
Molecular Function
External links
PDB RCSB:6ygi, PDBe:6ygi, PDBj:6ygi
PDBsum6ygi
PubMed32795390
UniProtP0C6J7|CAPSD_DHBV1 Capsid protein (Gene Name=C)

[Back to BioLiP]