Structure of PDB 6xn7 Chain D Binding Site BS01

Receptor Information
>6xn7 Chain D (length=135) Species: 1360 (Lactococcus lactis subsp. lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TELKIGNEKVNSTNFGDFAEKAIRGINHKPFVNSKGGEQKITTSKIRGIL
ELVNKVYNRVINTNDVELSENILADIAYIKVKIAYESGREPVVKDFIQRT
AFTAAITDVMNQRTRESFLLFARYVESLIAYFKFY
Ligand information
>6xn7 Chain T (length=37) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggaguugaagcuugguucaaagaacguauguucucg
.....................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xn7 Structural and biochemical characterization of in vivo assembled Lactococcus lactis CRISPR-Csm complex.
Resolution3.47 Å
Binding residue
(original residue number in PDB)		T53 T54 S55 K56 R58 E62 R100
Binding residue
(residue number reindexed from 1)		T42 T43 S44 K45 R47 E51 R89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6xn7, PDBe:6xn7, PDBj:6xn7
PDBsum6xn7
PubMed35351985
UniProtL0CFW2

[Back to BioLiP]