Structure of PDB 6xkb Chain D Binding Site BS01

Receptor Information

>6xkb Chain D (length=135) Species: 9606 (Homo sapiens)

MDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKF
IKKCKPEYKVPGLYVIDSIVRQSRHQFGTDKDVFGPRFSKNITATFQYLY
LCPSEDKSKIVRVLNLWQKNGVFKIEIIQPLLDMA

Ligand information

>6xkb Chain J (length=14) Species: 9606 (Homo sapiens)

SPSYSPTSPSYSPT

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6xkb Structural basis for the recognition of the S2, S5-phosphorylated RNA polymerase II CTD by the mRNA anti-terminator protein hSCAF4.
• Resolution: 1.6 Å
• Binding residue (original residue number in PDB): I21 S22 R23 M26 T30 K31 Y64 D67 S68 R71 Q72 H75 Q76 R112 L116
• Binding residue (residue number reindexed from 1): I21 S22 R23 M26 T30 K31 Y64 D67 S68 R71 Q72 H75 Q76 R112 L116

External links

• PDB: RCSB:6xkb, PDBe:6xkb, PDBj:6xkb
• PDBsum: 6xkb
• PubMed: 34897689
• UniProt: O95104|SCAF4_HUMAN SR-related and CTD-associated factor 4 (Gene Name=SCAF4)