Structure of PDB 6x0n Chain D Binding Site BS01

Receptor Information
>6x0n Chain D (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEA
SRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>6x0n Chain I (length=157) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caatacatgcacaggatgtatatatctgacacgtgcctggagactaggga
gtaatccccttggcggttaaaacgcgggggacagcgcgtacgtgcgttta
agcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggat
tctccag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x0n Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
Resolution10.0 Å
Binding residue
(original residue number in PDB)
R26 R27 R30 E32 Y39 S52 S53 S84
Binding residue
(residue number reindexed from 1)
R2 R3 R6 E8 Y15 S28 S29 S60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6x0n, PDBe:6x0n, PDBj:6x0n
PDBsum6x0n
PubMed32939087
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]