Structure of PDB 6wwc Chain D Binding Site BS01

Receptor Information
>6wwc Chain D (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLLQSGAELVRPGASVTLSCKASGYAFSDYEIHWVKQTPVRGLDWIGA
FDPKSGASASNQKVKGRAILTADKSSSTAYMELRSLTSEDSAVYYCTRLR
YFGYFDVWGTGTTVTVSSASTTPPSVYPLAPQTNSMVTLGCLVKGYFPEP
VTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH
PASSTKVDKKIVP
Ligand information
>6wwc Chain F (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wwc Mutational fitness landscapes reveal genetic and structural improvement pathways for a vaccine-elicited HIV-1 broadly neutralizing antibody.
Resolution2.563 Å
Binding residue
(original residue number in PDB)
E33 A50 A57 S58 Y101 F102 G103
Binding residue
(residue number reindexed from 1)
E33 A50 A57 S58 Y101 F102 G103
External links