Structure of PDB 6wl4 Chain D Binding Site BS01

Receptor Information
>6wl4 Chain D (length=177) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRAR
WMEQEGPEYWECETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISG
CEVGSDGRLLRGYQQYAYDGQDYIALNEDLKTWTAADMAALITKHKWEQA
GEAERLRAYLEGTCVEWLRRYLKNGNA
Ligand information
>6wl4 Chain E (length=8) Species: 11276 (Vesicular stomatitis virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RGYVYQGL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wl4 Pre-T cell receptors topologically sample self-ligands during thymocyte beta-selection.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		Y7 V9 E63 K66 N70 S73 F74 D77 V97 S99 K146 E152 R155 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 V9 E63 K66 N70 S73 F74 D77 V97 S99 K146 E152 R155 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6wl4, PDBe:6wl4, PDBj:6wl4
PDBsum6wl4
PubMed33335016
UniProtP01901|HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain (Gene Name=H2-K1)

[Back to BioLiP]