Structure of PDB 6wfq Chain D Binding Site BS01

Receptor Information
>6wfq Chain D (length=219) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKLSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAAL
KRKGLVQINNGERARVSRPSADTIIGELSGMAKDFLSHPGGIAHFEQLRL
FFESSLVRYAAEHATDEQIDLLAKALEINSQSLDNNAAFIRSDVDFHRVL
AEIPGNPIFMAIHVALLDWLIAARPTVTDQALHEHNNVSYQQHIAIVDAI
RRHDPDEADRALQSHLNSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wfq Mechanism of NanR gene repression and allosteric induction of bacterial sialic acid metabolism.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		E58 R59 N89 G90
Binding residue
(residue number reindexed from 1)		E29 R30 N60 G61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001046 core promoter sequence-specific DNA binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0042803 protein homodimerization activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0031334 positive regulation of protein-containing complex assembly
GO:0045892 negative regulation of DNA-templated transcription
GO:2000143 negative regulation of DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6wfq, PDBe:6wfq, PDBj:6wfq
PDBsum6wfq
PubMed33790291
UniProtP0A8W0|NANR_ECOLI HTH-type transcriptional repressor NanR (Gene Name=nanR)

[Back to BioLiP]