Structure of PDB 6we1 Chain D Binding Site BS01

Receptor Information
>6we1 Chain D (length=113) Species: 10834 (Wheat dwarf virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FRVYSKYLFLTYPQCTLEPQYALDSLRTLLNKYEPLYIAAVRELSPHLHV
LVQNKLRASITNPNALNLRMDTSPFSIFHPNIQAAKDCNQVRDFITKEVS
DVNTAEWGTFVAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6we1 Molecular underpinnings of ssDNA specificity by Rep HUH-endonucleases and implications for HUH-tag multiplexing and engineering.
Resolution2.612 Å
Binding residue
(original residue number in PDB)		F9 F17 T19 P21 Q22 H59 H61 P75 H91 P92 N93 I94 Q95 K98 D99 V103 F106
Binding residue
(residue number reindexed from 1)		F1 F9 T11 P13 Q14 H47 H49 P63 H79 P80 N81 I82 Q83 K86 D87 V91 F94
Enzymatic activity
Enzyme Commision number 2.7.7.-
3.1.21.-
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6we1, PDBe:6we1, PDBj:6we1
PDBsum6we1
PubMed33410911
UniProtQ67622|REP_WDVS Replication-associated protein (Gene Name=C1/C2)

[Back to BioLiP]