Structure of PDB 6wdz Chain D Binding Site BS01

Receptor Information
>6wdz Chain D (length=102) Species: 85708 (Porcine circovirus 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQPHKRWVFTLNNPSEDERKKIRDLPISLFDYFIVGEEGNEEGRTPHLQG
FANFVKKQTFNKVKWYLGARCHIEKAKGTDQQNKEFCSKEGNLLMECGAP
RS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wdz Molecular underpinnings of ssDNA specificity by Rep HUH-endonucleases and implications for HUH-tag multiplexing and engineering.
Resolution2.03 Å
Binding residue
(original residue number in PDB)		P11 V18 T20 N22 N23 T55 Q59 F70 K74 A79 R80 C81 H82 I83 E84 A86 K87 G88 Q92 N93 F96 K99
Binding residue
(residue number reindexed from 1)		P1 V8 T10 N12 N13 T45 Q49 F60 K64 A69 R70 C71 H72 I73 E74 A76 K77 G78 Q82 N83 F86 K89
Enzymatic activity
Enzyme Commision number 2.7.7.-
3.1.21.-
3.6.1.-
Gene Ontology
Biological Process
GO:0006260 DNA replication

View graph for
Biological Process
External links
PDB RCSB:6wdz, PDBe:6wdz, PDBj:6wdz
PDBsum6wdz
PubMed33410911
UniProtQ8BB16|REP_PCV2 Replication-associated protein (Gene Name=Rep)

[Back to BioLiP]