Structure of PDB 6wav Chain D Binding Site BS01

Receptor Information
>6wav Chain D (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWK
DISPAALPGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wav Structural basis for histone variant H3tK27me3 recognition by PHF1 and PHF19.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
L48 A81
Binding residue
(residue number reindexed from 1)
L22 A55
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6wav, PDBe:6wav, PDBj:6wav
PDBsum6wav
PubMed32869745
UniProtO43189|PHF1_HUMAN PHD finger protein 1 (Gene Name=PHF1)

[Back to BioLiP]