Structure of PDB 6w9z Chain D Binding Site BS01

Receptor Information
>6w9z Chain D (length=30) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPELTVALILGIFLGTFIAFWVVYLLRRLM
Ligand information
>6w9z Chain C (length=29) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PELTVALILGIFLGTFIAFWVVYLLRRLM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6w9z De novo designed receptor transmembrane domains enhance CAR-T cytotoxicity and attenuate cytokine release
Resolution2.7 Å
Binding residue
(original residue number in PDB)		E71 L72 A75 L76 G79 I80 G83 A87 V91
Binding residue
(residue number reindexed from 1)		E3 L4 A7 L8 G11 I12 G15 A19 V23
External links