Structure of PDB 6vqo Chain D Binding Site BS01

Receptor Information
>6vqo Chain D (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTY
SSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSGLKEDSSYK
LIFGSGTRLLVRPDIQNPDPAVYQLRDKSVCLFTDFDSQTNVSQSKDSDV
YITDKCVLDMRSMDFKSNSAVAWSNFACANAFNNSIIPEDTFF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vqo Structural basis for oligoclonal T cell recognition of a shared p53 cancer neoantigen.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
Y32 Y100
Binding residue
(residue number reindexed from 1)
Y31 Y99
External links