Structure of PDB 6vgg Chain D Binding Site BS01

Receptor Information
>6vgg Chain D (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGN
DENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQV
ATYHRAIKVTVDGPREP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vgg Allosteric interference in oncogenic FLI1 and ERG transactions by mithramycins.
Resolution4.31 Å
Binding residue
(original residue number in PDB)		R131 K134 T135 R186 R193 R225
Binding residue
(residue number reindexed from 1)		R21 K24 T25 R76 R83 R115
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005524 ATP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vgg, PDBe:6vgg, PDBj:6vgg
PDBsum6vgg
PubMed33275876
UniProtQ13950|RUNX2_HUMAN Runt-related transcription factor 2 (Gene Name=RUNX2)

[Back to BioLiP]