Structure of PDB 6vg8 Chain D Binding Site BS01

Receptor Information
>6vg8 Chain D (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGN
DENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQV
ATYHRAIKVTVDGPREPRRH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vg8 Allosteric interference in oncogenic FLI1 and ERG transactions by mithramycins.
Resolution4.31 Å
Binding residue
(original residue number in PDB)		R131 T135 R186 R225 R228
Binding residue
(residue number reindexed from 1)		R21 T25 R76 R115 R118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005524 ATP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vg8, PDBe:6vg8, PDBj:6vg8
PDBsum6vg8
PubMed33275876
UniProtQ13950|RUNX2_HUMAN Runt-related transcription factor 2 (Gene Name=RUNX2)

[Back to BioLiP]