Structure of PDB 6vbq Chain D Binding Site BS01

Receptor Information
>6vbq Chain D (length=208) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELTQPPSMSVSPGQTARITCSADVLPKQYAYWYQQKPGQAPLLLIYKDTE
RPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSTDSSDIYLVFGGG
TKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKA
DSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGS
TVEKTVAP
Ligand information
>6vbq Chain K (length=13) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KKQKVHALFYKLD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vbq HIV vaccine delayed boosting increases Env variable region 2-specific antibody effector functions.
Resolution2.116 Å
Binding residue
(original residue number in PDB)		L28 K30 Q31 Y32 D51 T91 D95 I95A
Binding residue
(residue number reindexed from 1)		L25 K27 Q28 Y29 D48 T88 D92 I93
External links