Structure of PDB 6v92 Chain D Binding Site BS01

Receptor Information
>6v92 Chain D (length=100) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGYYDVLAGLSALEKSSQVVFSATELQQLTQKRVAVHGYLGGKVSLADAA
QVEYEVGHSLLGSYVPRQQLEALSSVDFSHHFHRTLECKAALETHDVFLA
Ligand information
>6v92 Chain 3 (length=19) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6v92 Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
Resolution20.0 Å
Binding residue
(original residue number in PDB)		S90 Y91
Binding residue
(residue number reindexed from 1)		S63 Y64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0006325 chromatin organization
GO:0006337 nucleosome disassembly
GO:0006338 chromatin remodeling
GO:0006368 transcription elongation by RNA polymerase II
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0016586 RSC-type complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6v92, PDBe:6v92, PDBj:6v92
PDBsum6v92
PubMed31886770
UniProtP38210|LDB7_YEAST Chromatin structure-remodeling complex protein RSC14 (Gene Name=LDB7)

[Back to BioLiP]