Structure of PDB 6uph Chain D Binding Site BS01

Receptor Information
>6uph Chain D (length=96) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATESS
KLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS
Ligand information
>6uph Chain I (length=119) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacgc
acgtacgcgctgtcccccgcgttttaaccgccaaggggattactccctag
tctccaggcacgtgtcaga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uph Cryoelectron Microscopy Structure of a Yeast Centromeric Nucleosome at 2.7 angstrom Resolution.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		S92 T93
Binding residue
(residue number reindexed from 1)		S59 T60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6uph, PDBe:6uph, PDBj:6uph
PDBsum6uph
PubMed32004465
UniProtQ6CK60|H2B1_KLULA Histone H2B.1 (Gene Name=HTB1)

[Back to BioLiP]