Structure of PDB 6u9x Chain D Binding Site BS01

Receptor Information
>6u9x Chain D (length=294) Species: 5691 (Trypanosoma brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VHLSTIQLEKLSHPPARFDNSFVYKWQTKAALARKVSGPMREWAAELKYR
TGVHIELEPTYPERLSENAVQWGAYETADDVDITVYLFGSERGIFNCHKL
MEAAIQQDPVYVRLGIFRRLANSSEVEWLMLRRINRELRPPDIPPISLKL
PGKWTLLYERYKEAAIRTLWEETGITVDASNVYPTGHLYQTVPQYYWRVP
VRYFVAEVPSDIRVEGPQVVPLQYMRNWDARLLRQSPDPIDRAWAQLADP
ATGCAWMKASMIDQLQKPLRGDNYMAIRYTPPPYSNLQEVVGLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u9x Structures of MERS1, the 5' processing enzyme of mitochondrial mRNAs inTrypanosoma brucei.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		S112 M115 R116 Y197 R199 R219 N221 R222 L224 P226 I229 I232 S233 L234 K235 L274 Y275 Q276 W283 V285 V287 Y289 I326 Q352 L355 R356 Y360 R364
Binding residue
(residue number reindexed from 1)		S37 M40 R41 Y111 R113 R133 N135 R136 L138 P140 I143 I146 S147 L148 K149 L188 Y189 Q190 W197 V199 V201 Y203 I240 Q266 L269 R270 Y274 R278
Binding affinityPDBbind-CN: Kd=40nM
Enzymatic activity
Enzyme Commision number ?
External links