Structure of PDB 6u82 Chain D Binding Site BS01

Receptor Information
>6u82 Chain D (length=134) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRGRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIW
FQNERSRQLRQHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKD
RFPGIAAREELARETGLPESRIQIWFQNRRARHP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u82 DNA aptamers against the DUX4 protein reveal novel therapeutic implications for FSHD.
Resolution3.21 Å
Binding residue
(original residue number in PDB)		R20 R21 R23 L24 W26 Y43 R49 R62 Q64 W66 R71 R76 R79 R80 R95 R96 R98 T99 R124 R137 W141 Q143 R146
Binding residue
(residue number reindexed from 1)		R4 R5 R7 L8 W10 Y27 R33 R46 Q48 W50 R55 R60 R63 R64 R79 R80 R82 T83 R108 R121 W125 Q127 R130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6u82, PDBe:6u82, PDBj:6u82
PDBsum6u82
PubMed32020675
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]