Structure of PDB 6tro Chain D Binding Site BS01

Receptor Information
>6tro Chain D (length=189) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQVEQSPQSLIILEGKNVTLQCNYTVSPFSNLRWYKQDTGRGPVSLTIMT
FSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVNHSGGSYIP
TFGRGTSLIVHPYIQKPDPAVYQLRDSSVCLFTDFDSQTNVSQSSDVYIT
DKCVLDMRSMDFKSNSAVAWSACANAFNNSIIPEDTFFP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tro T cell receptor interactions with human leukocyte antigen govern indirect peptide selectivity for the cancer testis antigen MAGE-A4.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		S37 S109 Y114
Binding residue
(residue number reindexed from 1)		S30 S94 Y98
External links