Structure of PDB 6tqr Chain D Binding Site BS01

Receptor Information
>6tqr Chain D (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRR
YCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSD
MEAVWKEAKPDELMDSKLRCVFEMPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tqr FFAT motif phosphorylation controls formation and lipid transfer function of inter-organelle contacts.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		A9 K10 H11 E12
Binding residue
(residue number reindexed from 1)		A1 K2 H3 E4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005789 endoplasmic reticulum membrane

View graph for
Cellular Component
External links
PDB RCSB:6tqr, PDBe:6tqr, PDBj:6tqr
PDBsum6tqr
PubMed33124732
UniProtQ9P0L0|VAPA_HUMAN Vesicle-associated membrane protein-associated protein A (Gene Name=VAPA)

[Back to BioLiP]