Structure of PDB 6ta7 Chain D Binding Site BS01

Receptor Information
>6ta7 Chain D (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGADAVYGQKEI
HRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQT
FVLAPEGANKFYVHNDIFRYQDEVF
Ligand information
>6ta7 Chain G (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MAQMQGPYNFIQDSMLDFEN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ta7 Caprin-1 binding to the critical stress granule protein G3BP1 is regulated by pH
Resolution1.93 Å
Binding residue
(original residue number in PDB)		L10 V11 F15 R17 Q18 L22 Q25 H31 R32 F33 Q58 H62 N122 K123 F124 Y125
Binding residue
(residue number reindexed from 1)		L7 V8 F12 R14 Q15 L19 Q22 H28 R29 F30 Q47 H51 N109 K110 F111 Y112
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
3.6.4.13: RNA helicase.
External links
PDB RCSB:6ta7, PDBe:6ta7, PDBj:6ta7
PDBsum6ta7
PubMed
UniProtQ13283|G3BP1_HUMAN Ras GTPase-activating protein-binding protein 1 (Gene Name=G3BP1)

[Back to BioLiP]