Structure of PDB 6scs Chain D Binding Site BS01

Receptor Information
>6scs Chain D (length=74) Species: 196627 (Corynebacterium glutamicum ATCC 13032) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSYQSTIVPVELHSFEDAQVIGGAFRDGDAVVFDMSLLSREEARRIVDFA
AGLCFALRGKMQKIDSVTFAVVPE
Ligand information
>6scs Chain R (length=8) Species: 196627 (Corynebacterium glutamicum ATCC 13032) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DLDVPSFL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6scs Essential dynamic interdependence of FtsZ and SepF for Z-ring and septum formation in Corynebacterium glutamicum.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R102 R106 V109 A113 K125
Binding residue
(residue number reindexed from 1)		R40 R44 V47 A51 K63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0090529 cell septum assembly

View graph for
Biological Process
External links
PDB RCSB:6scs, PDBe:6scs, PDBj:6scs
PDBsum6scs
PubMed32242019
UniProtQ8NNN6

[Back to BioLiP]