Structure of PDB 6rsy Chain D Binding Site BS01

Receptor Information
>6rsy Chain D (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAKTTQPPSMDCAEGRAANLPCNHSTVDPNEYVYWYRQIHSQGPQYIIHG
LKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIGGGTTSGTYKY
IFGTGTRLKVLANIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSK
DSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rsy Specificity of bispecific T cell receptors and antibodies targeting peptide-HLA.
Resolution2.95 Å
Binding residue
(original residue number in PDB)
T95 S97 Y100
Binding residue
(residue number reindexed from 1)
T93 S95 Y98
External links