Structure of PDB 6rpa Chain D Binding Site BS01

Receptor Information
>6rpa Chain D (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQSVAQPEDQVNVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKY
ITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVRDINSGA
GSYQLTFGKGTKLSVIPNIQNPDPAVYQLRDSDKSVCLFTDFDSQDSDVY
ITDKCVLDFKSNSAVA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rpa TCRs with Distinct Specificity Profiles Use Different Binding Modes to Engage an Identical Peptide-HLA Complex.
Resolution2.56 Å
Binding residue
(original residue number in PDB)		R107 I109 S111 G112 S113 Y114
Binding residue
(residue number reindexed from 1)		R94 I96 S98 G101 S102 Y103
External links