Structure of PDB 6rmm Chain D Binding Site BS01

Receptor Information
>6rmm Chain D (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LFSQKSFLVLGFSNENESNIANIIKENAGKIMSLLSRTVADYAVVPLLGC
EVEATVGEVVTNTWLVTCIDYQTLFDPKSNPLFTPVPVMTGMTPLEDCVI
SFSQCAGAEKESLTFLANLLGASVQEYFVRKSNAKKGMFASTHLILKERG
GSKYEAAKKWNLPAVTIAWLLETARTGKRADESHFLIENS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rmm Phosphorylation-mediated interactions with TOPBP1 couple 53BP1 and 9-1-1 to control the G1 DNA damage checkpoint.
Resolution3.53 Å
Binding residue
(original residue number in PDB)
E677 Y678 F679 V680 R681 M689 K704
Binding residue
(residue number reindexed from 1)
E126 Y127 F128 V129 R130 M138 K153
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6rmm, PDBe:6rmm, PDBj:6rmm
PDBsum6rmm
PubMed31135337
UniProtQ92547|TOPB1_HUMAN DNA topoisomerase 2-binding protein 1 (Gene Name=TOPBP1)

[Back to BioLiP]