Structure of PDB 6q5y Chain D Binding Site BS01

Receptor Information
>6q5y Chain D (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFIWKGFINMPSVAKFVTKAYPVSGSPEYLTEDLPDSIQVGGRISPQTVW
DYVEKIKASGTKEICVVRFTPVTEEDQISYTLLFAYFSSRKRYGVAANNM
KQVKDMYLIPLGATDKIPHPLVPFDGPGLELHRPNLLLGLIIRQKLKRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6q5y PHF3 regulates neuronal gene expression through the new Pol II CTD reader domain SPOC
Resolution2.85 Å
Binding residue
(original residue number in PDB)
Q1252 T1253 Y1257 K1260 R1297
Binding residue
(residue number reindexed from 1)
Q47 T48 Y52 K55 R92
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6q5y, PDBe:6q5y, PDBj:6q5y
PDBsum6q5y
PubMed
UniProtQ92576|PHF3_HUMAN PHD finger protein 3 (Gene Name=PHF3)

[Back to BioLiP]