Structure of PDB 6pzq Chain D Binding Site BS01

Receptor Information

>6pzq Chain D (length=156) Species: 11259 (Human respiratory syncytial virus A2)

RNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDRT
EEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEE
LNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHK
SITINN

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 6pzq Chain D Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6pzq Structure of the Human Respiratory Syncytial Virus M2-1 Protein in Complex with a Short Positive-Sense Gene-End RNA.
• Resolution: 2.703 Å
• Binding residue (original residue number in PDB): C7 C15 C21 H25
• Binding residue (residue number reindexed from 1): C4 C12 C18 H22
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005198 structural molecule activity
• GO:0005515 protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0019083 viral transcription
• GO:0031564 transcription antitermination
• GO:0046782 regulation of viral transcription
• GO:0085033 symbiont-mediated activation of host NF-kappaB cascade

Cellular Component

• GO:0030430 host cell cytoplasm
• GO:0042025 host cell nucleus
• GO:0044423 virion component

External links

• PDB: RCSB:6pzq, PDBe:6pzq, PDBj:6pzq
• PDBsum: 6pzq
• PubMed: 32697936
• UniProt: P04545|M21_HRSVA Protein M2-1 (Gene Name=M2-1)