Structure of PDB 6px6 Chain D Binding Site BS01

Receptor Information
>6px6 Chain D (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLI
QSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVHTGARLMF
GDGTQLVVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDS
DVYITDKCVLDMRSMDFKSNSAVAWSNACANAFNNSIIPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6px6 A molecular basis for the T cell response in HLA-DQ2.2 mediated celiac disease.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
I30 Y31
Binding residue
(residue number reindexed from 1)
I30 Y31
Enzymatic activity
Enzyme Commision number ?
External links