Structure of PDB 6puz Chain D Binding Site BS01

Receptor Information
>6puz Chain D (length=48) Species: 11698,273057 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6puz Structural basis for strand-transfer inhibitor binding to HIV intasomes.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		W243 E246 G247 A248 V250 R263
Binding residue
(residue number reindexed from 1)		W22 E25 G26 A27 V29 R42
Enzymatic activity
Enzyme Commision number ?
2.7.7.-
2.7.7.49: RNA-directed DNA polymerase.
2.7.7.7: DNA-directed DNA polymerase.
3.1.-.-
3.1.13.2: exoribonuclease H.
3.1.26.13: retroviral ribonuclease H.
3.4.23.16: HIV-1 retropepsin.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity
GO:0008270 zinc ion binding
Biological Process
GO:0015074 DNA integration
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6puz, PDBe:6puz, PDBj:6puz
PDBsum6puz
PubMed32001521
UniProtP12497|POL_HV1N5 Gag-Pol polyprotein (Gene Name=gag-pol);
P39476|DN7D_SACS2 DNA-binding protein 7d (Gene Name=sso7d)

[Back to BioLiP]