Structure of PDB 6pep Chain D Binding Site BS01

Receptor Information
>6pep Chain D (length=144) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIPVTGSGFVAKDDSLRTFFDAMALQLKEPVIVSKMAARKKITGNFEFHD
PNALLEKLSLQLGLIWYFDGQAIYIYDASEMRNAVVSLRNVSLNEFNNFL
KRSGLYNKNYPLRGDNRKGTFYVSGPPVYVDMVVNAATMMDKQN
Ligand information
>6pep Chain b (length=28) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WLKGRSFQYGAEGYIKMSPGHWYFPSPL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pep T3S injectisome needle complex structures in four distinct states reveal the basis of membrane coupling and assembly.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		D39 K67 I68 T69
Binding residue
(residue number reindexed from 1)		D13 K41 I42 T43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009306 protein secretion

View graph for
Biological Process
External links
PDB RCSB:6pep, PDBe:6pep, PDBj:6pep
PDBsum6pep
PubMed31427728
UniProtP35672|SCTC1_SALTY SPI-1 type 3 secretion system secretin (Gene Name=sctC1)

[Back to BioLiP]