Structure of PDB 6pe0 Chain D Binding Site BS01

Receptor Information

>6pe0 Chain D (length=293) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DYEKNERTRIKAQENLRRIRRKQLVLNEYENQVALEVVAPEDIPVGFNDI
GGLDDIIEELKETIIYPLTMPHLYKHGGALLAAPSGVLLYGPPGCGKTML
AKAVAHESGASFINLHISTLTEKWYGDSNKIVRAVFSLAKKLQPSIIFID
QIDAVLGTRRSGEHEASGMVKAEFMTLWDGLTSTNASGVPNRIVVLGATN
RINDIDEAILRRMPKQFPVPLPGLEQRRRILELVLRGTKRDPDFDLDYIA
RVTAGMSGSDIKETCRDAAMAPMREYIRQHRASGKPLSEINPD

Ligand information

>6pe0 Chain G (length=10) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAAAAAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6pe0 Structure of the AAA protein Msp1 reveals mechanism of mislocalized membrane protein extraction.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	K186 W187 Y188 H227
Binding residue (residue number reindexed from 1)	K123 W124 Y125 H164

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0016887	ATP hydrolysis activity

	Biological Process
GO:0140570	extraction of mislocalized protein from mitochondrial outer membrane

	Cellular Component
GO:0005741	mitochondrial outer membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6pe0, PDBe:6pe0, PDBj:6pe0
PDBsum	6pe0
PubMed	31999255
UniProt	G0S654

[Back to BioLiP]