Structure of PDB 6pbw Chain D Binding Site BS01

Receptor Information
>6pbw Chain D (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGASVKVSCRASGYTFTNYAMHWVRQAPGQRLEWMGW
INAGNGYTKYSQKFQDRVTITRDTSATTAYMELSSLRSEDTAMYYCARDS
FYDILSPVYHYYGMDVWGQGTTVTVSSASTKGPSVFPLAPGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pbw Structure and mechanism of monoclonal antibody binding to the junctional epitope of Plasmodium falciparum circumsporozoite protein.
Resolution2.058 Å
Binding residue
(original residue number in PDB)		W50 N52 Y56 T57 F97 Y98 Y100F H100G Y100I
Binding residue
(residue number reindexed from 1)		W50 N52 Y57 T58 F101 Y102 Y109 H110 Y112
External links