Structure of PDB 6pbv Chain D Binding Site BS01

Receptor Information
>6pbv Chain D (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLVQSGAEVKKPGASVKVSCKASGFTFTDYAMHWVRQAPGQRLEWMGW
INAGNGYTKYSQKFQDRLTITRDTFASTVYMELSSLRSEDTTVYYCARDG
FCPSNTCSGYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPK
Ligand information
>6pbv Chain I (length=9) Species: 36329 (Plasmodium falciparum 3D7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GNPDPNANP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pbv Structure and mechanism of monoclonal antibody binding to the junctional epitope of Plasmodium falciparum circumsporozoite protein.
Resolution1.566 Å
Binding residue
(original residue number in PDB)		W50 N52 Y56 T57 F97 C98 S100 N100A T100B C100C S100D Y100G
Binding residue
(residue number reindexed from 1)		W50 N52 Y57 T58 F101 C102 S104 N105 T106 C107 S108 Y111
External links