Structure of PDB 6p60 Chain D Binding Site BS01

Receptor Information
>6p60 Chain D (length=211) Species: 9479 (Platyrrhini) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVLAQPPSVSGAPGQRVTLSCTGSNSNIGVNYVQWYQQLPGTAPKLLIYE
NNKRPSGVSDRFSGSQSGTSASLTITGLQSEDEADYYCQCYDISLGAHVF
GSGTELTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVEVA
WKADGSAVNAGVETTKPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTH
EGSTVEKTVAP
Ligand information
>6p60 Chain F (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p60 Vaccine-elicited NHP FP-targeting neutralizing antibody A12V163-a.02 in complex with HIV fusion peptide (residue 512-519)
Resolution2.498 Å
Binding residue
(original residue number in PDB)		N32 Y33 Q35 Y37 L47 Y50 E51 Y92 H99
Binding residue
(residue number reindexed from 1)		N31 Y32 Q34 Y36 L46 Y49 E50 Y91 H98
External links