Structure of PDB 6ozh Chain D Binding Site BS01

Receptor Information

>6ozh Chain D (length=239) Species: 7719 (Ciona intestinalis)

DEQIAEWNSKQEELRDKIIRSDGDFSLSKVKYVGGFDVSYSKINHELAVS
CMVVLSYPEMKQVYMNTTKVKLSCPYKSSYLAFREIEPFQQELQLLKAKK
PNLEPQVFLLDGNGFFHIRRCGAASHLGVLSNTRTIGVAKSLIEIPEDGV
KKTEVISQFKRLRKTGGNELDIISTEKNEVLAKAVLYAPKVEKPIFVSAG
HKCSLETAAKIVKGCTKTRIPEPIKMADKWSRKELKKIE

Ligand information

>6ozh Chain F (length=19)

aaccggatatgcagcattt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6ozh Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
• Resolution: 3.026 Å
• Binding residue (original residue number in PDB): K48 V197 E198 K199 T224 R225 K231 K235
• Binding residue (residue number reindexed from 1): K42 V191 E192 K193 T218 R219 K225 K229

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 00:33:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6ozh', asym_id = 'D', bs = 'BS01', title = 'Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6ozh', asym_id='D', bs='BS01', title='Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004519,0006281', uniprot = '', pdbid = '6ozh', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519,0006281', uniprot='', pdbid='6ozh', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>