Structure of PDB 6o09 Chain D Binding Site BS01

Receptor Information
>6o09 Chain D (length=261) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LYFQGMLELRLVQGSLLKKVLESIKDLVNDANFDCSSTGFSLQAMDSSHV
ALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDG
GDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSNEFS
RICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANIVLRQNTTVPEDAIVI
EMKEPVSLSFALRYMNSFTKATPLSDTVTISLSSELPVVVEYKVAEMGYI
RYYLAPKIEEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o09 ATXR5/6 Forms Alternative Protein Complexes with PCNA and the Nucleosome Core Particle.
Resolution2.06 Å
Binding residue
(original residue number in PDB)		H44 V45 H125 L126 G127 P129 S206 E232 P234 A252 P253 K254 I255 E256
Binding residue
(residue number reindexed from 1)		H49 V50 H130 L131 G132 P134 S209 E235 P237 A255 P256 K257 I258 E259
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0006275 regulation of DNA replication
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6o09, PDBe:6o09, PDBj:6o09
PDBsum6o09
PubMed30826376
UniProtQ9M7Q7|PCNA1_ARATH Proliferating cellular nuclear antigen 1 (Gene Name=PCNA)

[Back to BioLiP]